Proteintech, 20801-1-AP, C16orf13 Polyclonal antibody

Size: 20ul / 150ul The C16orf13 (20801-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf13 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20801-1-AP targets C16orf13 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HeLa cells, rat liver tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14718 Product name: Recombinant human C16orf13 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-107 aa of BC007207 Sequence: MLVAAAAERNKDPILHVLRQYLDPAQRGVRVLEVASGSGQHAAHFARAFPLAEWQPSDVDQRCLDRNPEWGLRDTALLEDLGKASGLLLERMVDMPANNKCLIFRKN Predict reactive species Full Name: chromosome 16 open reading frame 13 Calculated Molecular Weight: 204 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC007207 Gene Symbol: C16orf13 Gene ID (NCBI): 84326 RRID: AB_2878742 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96S19 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.