Proteintech, 20807-1-AP, Neuron navigator 1 Polyclonal antibody

Size: 20ul / 150ul The Neuron navigator 1 (20807-1-AP) by Proteintech is a Polyclonal antibody targeting Neuron navigator 1 in IHC, ELISA applications with reactivity to human, mouse, rat samples 20807-1-AP targets Neuron navigator 1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human heart tissue, human placenta tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Neuron navigator 1 (NAV1) gene encodes a large protein belongs to the Nav/unc-53 family and 7 isoforms of NAV1 are produced by alternative splicing. NAV1 is localized in cytoplasm and expressed at high levels in heart, skeletal muscle and placenta, and especially in neuronal growth cones. Besides its nucleotide binding activity, NAV1 interacts with tubulin and associates with a subset of microtubule plus end, therefore playing a role in neuronal migration. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14747 Product name: Recombinant human NAV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1359-1530 aa of BC007523 Sequence: LKVAPGPSSGSTPGQVPGSSALSSPRRSLGLALTHSFGPSLADTDLSPMDGISTCGPKEEVTLRVVVRMPPQHIIKGDLKQQEFFLGCSKVSGKVDWKMLDEAVFQVFKDYISKMDPASTLGLSTESIHGYSISHVKRVLDAEPPEMPPCRRGVNNISVSLKGLKEKCVDSL Predict reactive species Full Name: neuron navigator 1 Calculated Molecular Weight: 1877 aa, 202 kDa GenBank Accession Number: BC007523 Gene Symbol: NAV1 Gene ID (NCBI): 89796 RRID: AB_10732685 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NEY1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.