Proteintech, 20812-1-AP, APBA3 Polyclonal antibody

Size: 20ul / 150ul The APBA3 (20812-1-AP) by Proteintech is a Polyclonal antibody targeting APBA3 in WB, ELISA applications with reactivity to human samples 20812-1-AP targets APBA3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells, HT-1080 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The APBA (MINT) family is a family of adaptor proteins composed of APBA1 (MINT1), APBA2 (MINT2), and APBA3 (MINT3). These proteins are involved in neuronal protein transport and synaptic function. APBA3 plays an essential role in mediating the transport of APP from the TGN to the plasma membrane (PMID: 24410826). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14771 Product name: Recombinant human APBA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-412 aa of BC008338 Sequence: IAQAIGQAFAAAYSQFLRESGIDPSQVGVHPSPGARHLHNGDLDHFSNSDNCREVHLEKRRGEGLGVALVES Predict reactive species Full Name: amyloid beta (A4) precursor protein-binding, family A, member 3 Calculated Molecular Weight: 575 aa, 61 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC008338 Gene Symbol: APBA3 Gene ID (NCBI): 9546 RRID: AB_3669349 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O96018 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.