Proteintech, 20822-1-AP, GALNT10 Polyclonal antibody

Size: 20ul / 150ul The GALNT10 (20822-1-AP) by Proteintech is a Polyclonal antibody targeting GALNT10 in WB, IHC, ELISA applications with reactivity to human, mouse samples 20822-1-AP targets GALNT10 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SK-N-SH cells, HepG2 cells, mouse ovary tissue Positive IHC detected in: human liver cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GALNT10 is a member of the N-acetylgalactosyltransferase family and an enzyme that catalyzes the first step in O-glycan synthesis. O-glycosylation is closely related to cell recognition, tumor cell growth, metastasis and adhesion. GALNT10 can change the cell connection and communication environment between cells, thus achieving specific biological effects. GALNT10 is highly expressed in many tumors and the tumor migration and invasion ability can be suppressed by inhibiting the expression of GALNT10 (PMID: 33275228). GALNT10 is a prognostic biomarker of high-grade ovarian serous cancer (HGSC) patients (PMID: 31853576). GALNT10 has 4 isoforms with the molecular mass of 32, 41, 62 and 69 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14751 Product name: Recombinant human GALNT10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-603 aa of BC007224 Sequence: EYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN Predict reactive species Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) Calculated Molecular Weight: 603 aa, 69 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC007224 Gene Symbol: GALNT10 Gene ID (NCBI): 55568 RRID: AB_3085622 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86SR1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.