Proteintech, 20836-1-AP, FAM171A2 Polyclonal antibody

Size: 20ul / 150ul The FAM171A2 (20836-1-AP) by Proteintech is a Polyclonal antibody targeting FAM171A2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 20836-1-AP targets FAM171A2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, HUVEC cells Positive IHC detected in: mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:3000-1:9000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information FAM171A2 is a key regulator of progranulin expression and modifies the risk of multiple neurodegenerative diseases. In addition, FAM171A2 was considerably expressed in the vascular endothelium and microglia, which are rich in Progranulin (PGRN) (PMID: 33087363). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14909 Product name: Recombinant human FAM171A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC030200 Sequence: MPPASGPSVLARLLPLLGLLLGSASRAPGKSPPEPPSPQEILIKVQVYVSGELVPLARASVDVFGNRTLLAAGTTDSEGVATLPLSYRLGTWVLVTAARPGFLTNSVPWRVDKLPLYASVSLYLLPERPATLILYEDLVHILLGSPGARSQPLVQFQRRAARLPVSSTYSQLWASLTPASTQQEMRAFPAFLGTEASSSGNGSWLELMPL Predict reactive species Full Name: family with sequence similarity 171, member A2 Calculated Molecular Weight: 826 aa, 87 kDa Observed Molecular Weight: 65-75 kDa GenBank Accession Number: BC030200 Gene Symbol: FAM171A2 Gene ID (NCBI): 284069 RRID: AB_2878748 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A8MVW0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.