Iright
BRAND / VENDOR: Proteintech

Proteintech, 20847-1-AP, GPR3 Polyclonal antibody

CATALOG NUMBER: 20847-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPR3 (20847-1-AP) by Proteintech is a Polyclonal antibody targeting GPR3 in IHC, ELISA applications with reactivity to human, mouse samples 20847-1-AP targets GPR3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPR3 (G protein-coupled receptor 3) was first cloned from a mouse cDNA library in 1993 before being cloned from human genomic libraries by several independent groups (PMID: 29941868). GPR3 mRNA is broadly expressed in neurons in various brain regions, including the cortex, thalamus, hypothalamus, amygdala, hippocampus, pituitary, and cerebellum (PMID: 22207171). Moreover, the GPR3 protein is overexpressed in neurons in post-mortem brain tissue sections from individuals afflicted by Alzheimer's disease (PMID: 19213921). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14257 Product name: Recombinant human GPR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-330 aa of BC032702 Sequence: DAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV Predict reactive species Full Name: G protein-coupled receptor 3 Calculated Molecular Weight: 330 aa, 35 kDa GenBank Accession Number: BC032702 Gene Symbol: GPR3 Gene ID (NCBI): 2827 RRID: AB_2878749 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46089 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924