Iright
BRAND / VENDOR: Proteintech

Proteintech, 20851-1-AP, GRINA Polyclonal antibody

CATALOG NUMBER: 20851-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GRINA (20851-1-AP) by Proteintech is a Polyclonal antibody targeting GRINA in WB, IHC, ELISA applications with reactivity to human samples 20851-1-AP targets GRINA in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information Glutamate Receptor Ionotropic NMDA-Associated Protein 1 (GRINA, also known as TMBIM3) is a transmembrane protein involved in calcium homeostasis and cell survival. It plays a crucial role in regulating intracellular calcium levels, which are essential for processes such as cell survival, neurotransmitter release, and apoptosis (PMID: 32124700). GRINA also involves vesicle transport and sorting, particularly in secretory cells like neurons and mammary glands (PMID: 31426446). Additionally, GRINA has been implicated in regulating aerobic glycolysis and tumor progression in gastric cancer (PMID: 30541591). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14716 Product name: Recombinant human GRINA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC041788 Sequence: MSHEKSFLVSGDNYPPPNPGYPGGPQPPMPPYAQPPYPGAPYPQPPFQPSPYGQPGYPHGPSPYPQGGYPQGPYPQGGYPQGPYPQEGYPQGPYPQGGYPQGPYPQNPFPPNPYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRKVFLVLT Predict reactive species Full Name: glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding) Calculated Molecular Weight: 371 aa, 41 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC041788 Gene Symbol: GRINA Gene ID (NCBI): 2907 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z429 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924