Product Description
Size: 20ul / 150ul
The EZH1 (20852-1-AP) by Proteintech is a Polyclonal antibody targeting EZH1 in WB, ELISA applications with reactivity to human, mouse samples
20852-1-AP targets EZH1 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: RAW 264.7 cells, HL-60 cells, HEK-293T cells
Recommended dilution
Western Blot (WB): WB : 1:300-1:1000
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse, chicken
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14732 Product name: Recombinant human EZH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 161-267 aa of BC015882 Sequence: EEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPN Predict reactive species
Full Name: enhancer of zeste homolog 1 (Drosophila)
Calculated Molecular Weight: 747 aa, 85 kDa
Observed Molecular Weight: 80-95 kDa
GenBank Accession Number: BC015882
Gene Symbol: EZH1
Gene ID (NCBI): 2145
RRID: AB_10863659
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q92800
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924