Iright
BRAND / VENDOR: Proteintech

Proteintech, 20863-1-AP, FAM76A Polyclonal antibody

CATALOG NUMBER: 20863-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM76A (20863-1-AP) by Proteintech is a Polyclonal antibody targeting FAM76A in WB, IHC, ELISA applications with reactivity to human, mouse samples 20863-1-AP targets FAM76A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, HeLa cells, Jurkat cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAM76A is a member of FAM76 family. It is reported that FAM76A may be regulated by WTAP. FAM76A is highly expressed in the WTAP high-expression group and also expressed at low levels in the WTAP low-expression group, which can be confirmed by TCGA data (PMID: 32998774). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14904 Product name: Recombinant human FAM76A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 142-227 aa of BC025768 Sequence: QRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVAT Predict reactive species Full Name: family with sequence similarity 76, member A Calculated Molecular Weight: 307 aa, 35 kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC025768 Gene Symbol: FAM76A Gene ID (NCBI): 199870 RRID: AB_10693681 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924