Proteintech, 20878-1-AP, LZTS1 Polyclonal antibody

Size: 20ul / 150ul The LZTS1 (20878-1-AP) by Proteintech is a Polyclonal antibody targeting LZTS1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 20878-1-AP targets LZTS1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, human testis tissue, mouse ovary tissue, mouse thymus tissue, PC-3 cells, rat brain tissue, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14977 Product name: Recombinant human LZTS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 397-596 aa of BC075007 Sequence: QLKESQTEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI Predict reactive species Full Name: leucine zipper, putative tumor suppressor 1 Calculated Molecular Weight: 596 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC075007 Gene Symbol: LZTS1 Gene ID (NCBI): 11178 RRID: AB_10693683 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y250 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.