Proteintech, 20890-1-AP, METTL17 Polyclonal antibody

Size: 20ul / 150ul The METTL17 (20890-1-AP) by Proteintech is a Polyclonal antibody targeting METTL17 in IHC, ELISA applications with reactivity to human samples 20890-1-AP targets METTL17 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14518 Product name: Recombinant human METT11D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC005053 Sequence: MAAALKCLLTLGRWCPGLGVAPQARALAALVPGVTQVDNKSGFLQKRPHRQHPGILKLPHVRLPQALANGAQLLLLGSAGPTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKKFLENPDLSQTEEKLRGAVLHALRKTTYHWQELSYTEGLSLVYMAARLDGGFAAVSRAFHEIRARNPAFQPQTLMDFGSGTGSVTWAAHSIWGQSLREYMCVDRSAAMLVLAEKLLKGGSESGEPYIPGVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEVVQTLWRKTGHFLVLVENGTKAGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLTNLACSFSQ Predict reactive species Full Name: methyltransferase 11 domain containing 1 Calculated Molecular Weight: 478 aa, 53 kDa GenBank Accession Number: BC005053 Gene Symbol: METT11D1 Gene ID (NCBI): 64745 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H7H0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.