Proteintech, 20898-1-AP, SLC47A1 Polyclonal antibody

Size: 20ul / 150ul The SLC47A1 (20898-1-AP) by Proteintech is a Polyclonal antibody targeting SLC47A1 in WB, ELISA applications with reactivity to human, mouse, rat samples 20898-1-AP targets SLC47A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15013 Product name: Recombinant human SLC47A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 449-570 aa of BC010661 Sequence: QAVCFLGFIIQLNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLLLGVFLILLVGILVRFYVRIQ Predict reactive species Full Name: solute carrier family 47, member 1 Calculated Molecular Weight: 570 aa, 62 kDa Observed Molecular Weight: 62 kDa, 32 and 50 kDa GenBank Accession Number: BC010661 Gene Symbol: SLC47A1 Gene ID (NCBI): 55244 RRID: AB_2878759 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96FL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.