Proteintech, 20900-1-AP, ZNF496 Polyclonal antibody

Size: 20ul / 150ul The ZNF496 (20900-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF496 in WB, ELISA applications with reactivity to human, mouse, Rat samples 20900-1-AP targets ZNF496 in WB, ELISA applications and shows reactivity with human, mouse, Rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, PC-12 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15015 Product name: Recombinant human ZNF496 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-587 aa of BC007263 Sequence: LDPAQTGFYGEFIIGEDYGVSMPPNDLAAQPDLSQGEENEPRVPELQDLQGKEVPQVSYLDSPSLQPFQVEERRKREELQVPEFQACPQTVVPQNTYPAGGNPRSLENSLDEEVTIEIVLSSSGDEDSQHGPYCTEELGSPTEKQRSLPASHRSSTEAGGEVQTSKKSYVCPNCGKIFRWRVNFIRHLRSRREQEKPHECSVCGELFSDSEDLDGHLESHEAQKPYRCGACGKSFRLNSHLLSHRRIHLQPDRLQPVEKREQAASEDADKGPKEPLENGKAKLSFQCCECGKAFQRHDHLARHRSHFHLKDKARPFQCRYCVKSFTQNYDLLRHERLHMKRRSKQALNSY Predict reactive species Full Name: zinc finger protein 496 Calculated Molecular Weight: 587 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC007263 Gene Symbol: ZNF496 Gene ID (NCBI): 84838 RRID: AB_2878761 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96IT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.