Iright
BRAND / VENDOR: Proteintech

Proteintech, 20916-1-AP, WDR37 Polyclonal antibody

CATALOG NUMBER: 20916-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WDR37 (20916-1-AP) by Proteintech is a Polyclonal antibody targeting WDR37 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20916-1-AP targets WDR37 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The function of WDR37 remains largely unknown. Catalog#20916-1-AP is a rabbit polyclonal antibody raised against the full-length of human WDR37. The MW of this protein is 55 kDa, and this antibody specially recognises the 55 kDa protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15112 Product name: Recombinant human WDR37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-244 aa of BC018044 Sequence: MPTESASCSTTRQTKQKRKSHSLSIRRTNSSEQERTGLPRDMLEGQDSKLPSSVRSTLLELFGQIEREFENLYIENLELRREIDTLNERLAAEGQAIDGAELSKGQLKTKASHSTSQLSQKLKTTYKASTSKIVSSFKTTTSRAACQLVKEYIGHRDGIWDVSVAKTQPVVLGTASADHTALLWSIETGKCLVKYAGHVGSVNSIKFHPSEQLALTASGDKTAHIWRYAVQLPTPQPVADTSVS Predict reactive species Full Name: WD repeat domain 37 Calculated Molecular Weight: 494 aa, 55 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC018044 Gene Symbol: WDR37 Gene ID (NCBI): 22884 RRID: AB_10695501 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2I8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924