Iright
BRAND / VENDOR: Proteintech

Proteintech, 20932-1-AP, TBR1 Polyclonal antibody

CATALOG NUMBER: 20932-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TBR1 (20932-1-AP) by Proteintech is a Polyclonal antibody targeting TBR1 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 20932-1-AP targets TBR1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human brain tissue, mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information TBR1, also named as T-box brain protein 1, is a 682 amino acid protein, which contains one T-box DNA-binding domain and localizes in the nucleus. TBR1 is expressed in the brain and as a transcriptional regulator is involved in developmental processes. TBR1 is required for normal brain development. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14935 Product name: Recombinant human TBR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC104844 Sequence: MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLSQSSQPQSAATAPSAMFPYPGQHGPAHPAFSIGSPSRYMAHHPVITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQ Predict reactive species Full Name: T-box, brain, 1 Calculated Molecular Weight: 682 aa, 74 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC104844 Gene Symbol: TBR1 Gene ID (NCBI): 10716 RRID: AB_10695502 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16650 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924