Proteintech, 21039-1-AP, FRMD6/Willin Polyclonal antibody

Size: 20ul / 150ul The FRMD6/Willin (21039-1-AP) by Proteintech is a Polyclonal antibody targeting FRMD6/Willin in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 21039-1-AP targets FRMD6/Willin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U2OS cells Positive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information Willin, also known as FRMD6 or human Expanded (hEx), is a member of the FERM-domain family of cytoskeletal crosslinkers. It is a potent inhibitor of cell proliferation, transformation and modulator of drug sensitivity, suggesting it possesses tumor suppressor properties. Willin is widely expressed in normal tissues. Although willin is found in the cytoplasm and membrane, it localizes to the nuclei of almost all tumors.This antibody was raised against the C-terminal region of human FRMD6 protein and is expected to recognize the endogenous FRMD6. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15375 Product name: Recombinant human Willin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC029870 Sequence: LDMDQLEKRSRASGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRKLKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMCIYITEDMLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFPVKRTSKYFSLDLTHDEVPEFVV Predict reactive species Full Name: FERM domain containing 6 Calculated Molecular Weight: 622 aa, 72 kDa Observed Molecular Weight: 72, 70, 30 kDa GenBank Accession Number: BC029870 Gene Symbol: FRMD6/Willin Gene ID (NCBI): 122786 RRID: AB_2878797 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96NE9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.