Proteintech, 21043-1-AP, MED26 Polyclonal antibody

Size: 20ul / 150ul The MED26 (21043-1-AP) by Proteintech is a Polyclonal antibody targeting MED26 in WB, ELISA applications with reactivity to human, mouse, rat samples 21043-1-AP targets MED26 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse ovary tissue, HEK-293 cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information MED26 (Mediator complex subunit 26), also known as ARC70 or CRSP7, is a metazoan-specific Mediator subunit essential for transcription regulation. MED26 plays a critical role in the transition from transcription initiation to elongation. It acts as a molecular switch, with its conserved N-terminal domain facilitating the exchange of the initiation factor TFIID for the super elongation complex (SEC), which contains factors such as ELL/EAF and P-TEFb, thereby promoting RNA polymerase II elongation (PMID: 21729782, PMID: 33836240). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15381 Product name: Recombinant human MED26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 251-600 aa of BC110430 Sequence: QQLDRVDETPGPPHPKGPPRCSFSPRNSRHEGSFARQQSLYAPKGSVPSPSPRPQALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSLAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIKPLTQKEPVRADSPVHMEQQSRTELDKQEAKASLQSPFEQTNWKELSRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD Predict reactive species Full Name: mediator complex subunit 26 Calculated Molecular Weight: 600 aa, 65 kDa Observed Molecular Weight: 66-70 kDa GenBank Accession Number: BC110430 Gene Symbol: MED26 Gene ID (NCBI): 9441 RRID: AB_10733342 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95402 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.