Iright
BRAND / VENDOR: Proteintech

Proteintech, 21045-1-AP, ESRP1 Polyclonal antibody

CATALOG NUMBER: 21045-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ESRP1 (21045-1-AP) by Proteintech is a Polyclonal antibody targeting ESRP1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 21045-1-AP targets ESRP1 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, mouse lung tissue, MCF-7 cells Positive IP detected in: COLO 320 cells Positive IHC detected in: human lung tissue, mouse colon tissue, human bowen diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ESRP1, also named as Epithelial splicing regulatory protein 1, is a 681 amino acid protein, which belongs to the ESRP family. ESRP1 as a mRNA splicing factor that regulates the formation of epithelial cell-specific isoforms. ESRP1 specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2 and also regulates the splicing of CD44, CTNND1, ENAH, 3 transcripts that undergo changes in splicing during the epithelial-to-mesenchymal transition (EMT). ESRP1 exists various isoforms and molecular weight of each isoform is 76 kDa, 67 kDa, and 73 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15386 Product name: Recombinant human ESRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-226 aa of BC099916 Sequence: EKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDNTV Predict reactive species Full Name: epithelial splicing regulatory protein 1 Calculated Molecular Weight: 681 aa, 76 kDa Observed Molecular Weight: 76 kDa GenBank Accession Number: BC099916 Gene Symbol: ESRP1 Gene ID (NCBI): 54845 RRID: AB_2878801 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NXG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924