Iright
BRAND / VENDOR: Proteintech

Proteintech, 21056-1-AP, VSIG2 Polyclonal antibody

CATALOG NUMBER: 21056-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VSIG2 (21056-1-AP) by Proteintech is a Polyclonal antibody targeting VSIG2 in IHC, ELISA applications with reactivity to human, mouse samples 21056-1-AP targets VSIG2 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information VSIG2, also known as CTXL (cortical thymocyte-like protein), belongs to the V-Set and immunoglobulin (Ig) domain-containing (VSIG) family. The VSIG family is also a member of the immunoglobulin superfamily (IgSF). VSIG2 has been recognized as a novel immune checkpoint that plays a role in regulating immune response. VSIG2 was associated with the development and progression of colon adenocarcinoma (COAD) and pancreatic ductal adenocarcinoma (PDAC) and could be used as a potential biomarker(PMID: 34290531;PMID: 37626304). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14342 Product name: Recombinant human VSIG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-243 aa of BC007313 Sequence: VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCVATNQMGSASCELTLSVTEPSQGRVA Predict reactive species Full Name: V-set and immunoglobulin domain containing 2 Calculated Molecular Weight: 327 aa, 34 kDa GenBank Accession Number: BC007313 Gene Symbol: VSIG2 Gene ID (NCBI): 23584 RRID: AB_3669354 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96IQ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924