Iright
BRAND / VENDOR: Proteintech

Proteintech, 21068-1-AP, MAZ Polyclonal antibody

CATALOG NUMBER: 21068-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAZ (21068-1-AP) by Proteintech is a Polyclonal antibody targeting MAZ in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 21068-1-AP targets MAZ in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse lung tissue Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Myc-associated zinc finger protein (MAZ) is a six zinc finger protein with a G-rich binding motif. MAZ is often found at genomic binding sites adjacent to CTCF, a protein which affects large-scale genome organization through its interaction with cohesin (PMID: 33558242). MAZ is widely expressed in most human tissues, such as heart, lung, brain, liver, placenta, testis, colon, peripheral blood leukocytes, skeletal muscle, thymus, pancreas, prostate, thyroid, and adrenal gland (PMID: 35098656). In cancer, MAZ has been proved to be highly expressed in malignant tumors, and to promote cancer progression and metastasis by regulating the transcription of downstream target genes through directly binding with target gene promoters or synergistic action with other transcription factors. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15200 Product name: Recombinant human MAZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC041629 Sequence: MVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKG Predict reactive species Full Name: MYC-associated zinc finger protein (purine-binding transcription factor) Calculated Molecular Weight: 477 aa, 49 kDa Observed Molecular Weight: 49-55 kDa GenBank Accession Number: BC041629 Gene Symbol: MAZ Gene ID (NCBI): 4150 RRID: AB_2878805 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56270 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924