Proteintech, 21071-1-AP, ADORA2B Polyclonal antibody

Size: 20ul / 150ul The ADORA2B (21071-1-AP) by Proteintech is a Polyclonal antibody targeting ADORA2B in WB, ELISA applications with reactivity to human, mouse samples 21071-1-AP targets ADORA2B in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15214 Product name: Recombinant human ADORA2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 278-332 aa of BC025722 Sequence: LSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL Predict reactive species Full Name: adenosine A2b receptor Calculated Molecular Weight: 332 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC025722 Gene Symbol: ADORA2B Gene ID (NCBI): 136 RRID: AB_2918069 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29275 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.