Product Description
Size: 20ul / 150ul
The GPRC5D (21089-1-AP) by Proteintech is a Polyclonal antibody targeting GPRC5D in WB, IHC, ELISA applications with reactivity to human samples
21089-1-AP targets GPRC5D in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Jurkat cells, MG-63 cells, THP-1 cells, U266 cells
Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag15338 Product name: Recombinant human GPRC5D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 256-345 aa of BC069341 Sequence: LYIVPELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV Predict reactive species
Full Name: G protein-coupled receptor, family C, group 5, member D
Calculated Molecular Weight: 345 aa, 39 kDa
Observed Molecular Weight: 34 kDa
GenBank Accession Number: BC069341
Gene Symbol: GPRC5D
Gene ID (NCBI): 55507
RRID: AB_2878810
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NZD1
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924