Proteintech, 21089-1-AP, GPRC5D Polyclonal antibody

Size: 20ul / 150ul The GPRC5D (21089-1-AP) by Proteintech is a Polyclonal antibody targeting GPRC5D in WB, IHC, ELISA applications with reactivity to human samples 21089-1-AP targets GPRC5D in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MG-63 cells, THP-1 cells, U266 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15338 Product name: Recombinant human GPRC5D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 256-345 aa of BC069341 Sequence: LYIVPELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV Predict reactive species Full Name: G protein-coupled receptor, family C, group 5, member D Calculated Molecular Weight: 345 aa, 39 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC069341 Gene Symbol: GPRC5D Gene ID (NCBI): 55507 RRID: AB_2878810 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.