Proteintech, 21114-1-AP, PCMTD2 Polyclonal antibody

Size: 20ul / 150ul The PCMTD2 (21114-1-AP) by Proteintech is a Polyclonal antibody targeting PCMTD2 in WB, ELISA applications with reactivity to human samples 21114-1-AP targets PCMTD2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PCMTD2 (Protein-L-isoaspartate O-methyltransferase domain-containing protein 2) has also been linked to various disease states including neurodevelopmental disorders and cancer. CUL5 E3 ligase complex can target CD247 and IL2RB through its adaptor protein PCMTD2. PCMTD2 is expressed in pigmented layer of retina. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15347 Product name: Recombinant human PCMTD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 248-361 aa of BC033665 Sequence: RIAIRGTIKKIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDLEEERREEEEKTPPETKPDPPVNFLRQKVLSLPLPDPLKYYLLYYREK Predict reactive species Full Name: protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 2 Calculated Molecular Weight: 361 aa, 41 kDa Observed Molecular Weight: 38-41 kDa GenBank Accession Number: BC033665 Gene Symbol: PCMTD2 Gene ID (NCBI): 55251 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NV79 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.