Iright
BRAND / VENDOR: Proteintech

Proteintech, 21137-1-AP, SPACA3 Polyclonal antibody

CATALOG NUMBER: 21137-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPACA3 (21137-1-AP) by Proteintech is a Polyclonal antibody targeting SPACA3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21137-1-AP targets SPACA3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse testis tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information SPACA3, also named as LYC3, LYZL3, SLLP1, SPRASA, CT54 and ALLP-17, belongs to the glycosyl hydrolase 22 family. It is a sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which is present in the extracellular matrix over the egg plasma membrane. SPACA3 has a Dimer form(PMID:15982649 ). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15589 Product name: Recombinant human SPACA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-123 aa of BC029867 Sequence: PYAGVCLAYFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF Predict reactive species Full Name: sperm acrosome associated 3 Calculated Molecular Weight: 215 aa, 23 kDa Observed Molecular Weight: 28-32 kDa, 46-50 kDa GenBank Accession Number: BC029867 Gene Symbol: SPACA3 Gene ID (NCBI): 124912 RRID: AB_10913810 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXA5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924