Iright
BRAND / VENDOR: Proteintech

Proteintech, 21143-1-AP, FLJ23584 Polyclonal antibody

CATALOG NUMBER: 21143-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FLJ23584 (21143-1-AP) by Proteintech is a Polyclonal antibody targeting FLJ23584 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 21143-1-AP targets FLJ23584 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, human brain tissue, L02 cells, mouse liver tissue Positive IHC detected in: human brain tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information FLJ23584 is coded by the mRNA of chromosome 22 open reading frame 46. The reading frame is different to C22orf46. This antibody detects the hypothetical FLJ23584 protein. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15647 Product name: Recombinant human CTA-216E10.6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC007210 Sequence: MNPVPHWGEVFLLVGGEGEHLASQGTTPARDHRVGISPASQQAQPESWRRRQRDKGVDPEKAPSLTRQSQNPPSLTAPLGMPSACSCLPCGPAPEAAIILAGPPTALTVLPKGTGLKKSKRLLLESLMRRRIAHLKWGLPRRILESYFLFNFLGSCSLTLAGARLSGLNTGQELQAQQERYCEAQGSPPGLKSPERFQRVQRPDRKSSKLPIQARALERNRPHMSEPIKHFHPA Predict reactive species Full Name: hypothetical FLJ23584 Calculated Molecular Weight: 234 aa, 26 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC007210 Gene Symbol: FLJ23584 Gene ID (NCBI): 79640 RRID: AB_10732689 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: C9J442 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924