Proteintech, 21148-1-AP, EBF3 Polyclonal antibody

Size: 20ul / 150ul The EBF3 (21148-1-AP) by Proteintech is a Polyclonal antibody targeting EBF3 in WB, ELISA applications with reactivity to human samples 21148-1-AP targets EBF3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15693 Product name: Recombinant human EBF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-543 aa of BC126130 Sequence: CNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVLLKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTSMNGYGSGAMASLGVPGSPGFLNGSSANSPYGMKQKSAFAPVVRPQASPPPSCTSANGNGLQAM Predict reactive species Full Name: early B-cell factor 3 Calculated Molecular Weight: 596 aa, 65 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC126130 Gene Symbol: EBF3 Gene ID (NCBI): 253738 RRID: AB_10732811 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H4W6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.