Iright
BRAND / VENDOR: Proteintech

Proteintech, 21150-1-AP, SLITRK6 Polyclonal antibody

CATALOG NUMBER: 21150-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLITRK6 (21150-1-AP) by Proteintech is a Polyclonal antibody targeting SLITRK6 in WB, ELISA applications with reactivity to human, mouse, rat samples 21150-1-AP targets SLITRK6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLITRK6 is a member of the SLITRK family. Members of this family are integral membrane proteins that are characterized by two N-terminal leucine-rich repeat (LRR) domains and a C-terminal region that shares homology with trk neurotrophin receptors. This protein functions as a regulator of neurite outgrowth required for normal hearing and vision. Mutations in SLITRK6 gene are a cause of myopia and deafness. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15701 Product name: Recombinant human SLITRK6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 621-816 aa of BC101070 Sequence: IVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSMYGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQT Predict reactive species Full Name: SLIT and NTRK-like family, member 6 Calculated Molecular Weight: 841 aa, 95 kDa Observed Molecular Weight: 95-100 kDa GenBank Accession Number: BC101070 Gene Symbol: SLITRK6 Gene ID (NCBI): 84189 RRID: AB_10732812 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H5Y7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924