Proteintech, 21153-1-AP, LILRA4 Polyclonal antibody

Size: 20ul / 150ul The LILRA4 (21153-1-AP) by Proteintech is a Polyclonal antibody targeting LILRA4 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 21153-1-AP targets LILRA4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, HL-60 cells, L02 cells Positive IF/ICC detected in: HL-60 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15721 Product name: Recombinant human LILRA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-153 aa of BC109198 Sequence: VVTSGVNVTLRCASRLGLGRFTLIEEGDHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSDPLQLLVSG Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4 Calculated Molecular Weight: 499 aa, 55 kDa Observed Molecular Weight: 48-55 kDa GenBank Accession Number: BC109198 Gene Symbol: LILRA4 Gene ID (NCBI): 23547 RRID: AB_10755291 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P59901 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.