Proteintech, 21157-1-AP, CXCL4/PF4 Polyclonal antibody

Size: 20ul / 150ul The CXCL4/PF4 (21157-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL4/PF4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, pig samples 21157-1-AP targets CXCL4/PF4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: Human peripheral blood platelets tissue, mouse spleen tissue Positive IP detected in: mouse serum Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The chemokine (C-X-C motif) ligand 4 (CXCL4) is also named as PF4 (Platelet factor-4) and SCYB4. The platelets, the most abundant source of CXCL4 in vivo, control profibrotic macrophage activation via CXCL4. (PMID: 36807143). Exogenous CXCL4 drove profibrotic activation of monocyte-derived dendritic cells in vitro (PMID: 33042127). Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. Specification Tested Reactivity: human, mouse, pig Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12345 Product name: Recombinant human PF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC093965 Sequence: MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES Predict reactive species Full Name: platelet factor 4 Calculated Molecular Weight: 101 aa, 11 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC093965 Gene Symbol: PF4 Gene ID (NCBI): 5196 RRID: AB_2878819 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02776 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.