Proteintech, 21180-1-AP, S1PR2 Polyclonal antibody

Size: 20ul / 150ul The S1PR2 (21180-1-AP) by Proteintech is a Polyclonal antibody targeting S1PR2 in WB, IF-P, IF-Fro, ELISA applications with reactivity to human samples 21180-1-AP targets S1PR2 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HuH-7 cells, MCF-7 cells, MDA-MB-231 cells Positive IF-P detected in: mouse brain tissue Positive IF-Fro detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information S1PR2 (sphingosine-1-phosphate receptor 2), also known as S1P2 or EDG5, is one of five G-protein-coupled receptors for sphingosine-1-phosphate (S1P), a biologically active metabolic product of sphingolipid (PMID: 18787560). S1P and its receptors have important regulatory functions in normal physiology and disease processes, particularly involving the immune, central nervous, and cardiovascular systems (PMID: 21339489). S1PR2 plays a role in acute vascular inflammation (PMID: 23723450). S1PR2 signaling is implicated in STAT3 activation (PMID: 22606352). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15470 Product name: Recombinant human S1PR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-353 aa of BC069598 Sequence: LNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV Predict reactive species Full Name: sphingosine-1-phosphate receptor 2 Calculated Molecular Weight: 353 aa, 39 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC069598 Gene Symbol: S1PR2 Gene ID (NCBI): 9294 RRID: AB_10694573 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95136 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.