Iright
BRAND / VENDOR: Proteintech

Proteintech, 21196-1-AP, EYA3 Polyclonal antibody

CATALOG NUMBER: 21196-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EYA3 (21196-1-AP) by Proteintech is a Polyclonal antibody targeting EYA3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 21196-1-AP targets EYA3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells Positive IP detected in: L02 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information EYA3(Eyes absent homolog 3) belongs to the HAD-like hydrolase superfamily.Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis.EYA3, like EYA1, is expressed in the ninth week of human development and may also underlie developmental defects(PMID:9020840).It has 2 isoforms produced by alternative splicing.This antibody is specific to EYA3. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15544 Product name: Recombinant human EYA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC029500 Sequence: MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDYTSQMYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDS Predict reactive species Full Name: eyes absent homolog 3 (Drosophila) Calculated Molecular Weight: 573 aa, 63 kDa Observed Molecular Weight: 63-66 kDa GenBank Accession Number: BC029500 Gene Symbol: EYA3 Gene ID (NCBI): 2140 RRID: AB_10732957 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99504 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924