Proteintech, 21242-1-AP, TCF3 Polyclonal antibody

Size: 20ul / 150ul The TCF3 (21242-1-AP) by Proteintech is a Polyclonal antibody targeting TCF3 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21242-1-AP targets TCF3 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, PC-3 cells, K-562 cells, NIH/3T3 cells Positive IP detected in: Jurkat cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15734 Product name: Recombinant human TCF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 318-480 aa of BC110580 Sequence: WPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTRCQ Predict reactive species Full Name: transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) Calculated Molecular Weight: 654 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC110580 Gene Symbol: TCF3 Gene ID (NCBI): 6929 RRID: AB_10755295 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15923 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.