Iright
BRAND / VENDOR: Proteintech

Proteintech, 21247-1-AP, ITIH3 Polyclonal antibody

CATALOG NUMBER: 21247-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ITIH3 (21247-1-AP) by Proteintech is a Polyclonal antibody targeting ITIH3 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 21247-1-AP targets ITIH3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human serum tissue Positive IP detected in: human plasma tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ITIH3, or inter-alpha-trypsin inhibitor heavy chain 3, is a gene in humans that encodes the heavy chain subunit of the pre-alpha-trypsin inhibitor complex. This complex plays a role in stabilizing the extracellular matrix through its ability to bind hyaluronic acid. The gene is located on chromosome 3 and is part of the inter-alpha-trypsin inhibitor family gene cluster. ITIH3 has restricted expression primarily toward the liver, with an RPKM value of 228.8, indicating a relatively high level of expression in this organ. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15750 Product name: Recombinant human ITIH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 601-782 aa of BC107604 Sequence: MVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGDPHFIIQIPEKDDALCFNIDEAPGTVLRLIQDAVTGLTVNGQITGDKRGSPDSKTRKTYFGKLGIANAQMDFQVEVTTEKITLWNRAVPSTFSWLDTVTVTQDGLSMMINRKNMVVSFGDGVTFVVVLHQVW Predict reactive species Full Name: inter-alpha (globulin) inhibitor H3 Calculated Molecular Weight: 890 aa, 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC107604 Gene Symbol: ITIH3 Gene ID (NCBI): 3699 RRID: AB_2878830 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q06033 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924