Proteintech, 21249-1-AP, AGRP Polyclonal antibody

Size: 20ul / 150ul The AGRP (21249-1-AP) by Proteintech is a Polyclonal antibody targeting AGRP in IHC, ELISA applications with reactivity to human, mouse samples 21249-1-AP targets AGRP in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissue, human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15752 Product name: Recombinant human AGRP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-132 aa of BC110443 Sequence: GAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT Predict reactive species Full Name: agouti related protein homolog (mouse) Calculated Molecular Weight: 132 aa, 14 kDa GenBank Accession Number: BC110443 Gene Symbol: AGRP Gene ID (NCBI): 181 RRID: AB_2878831 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00253 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.