Iright
BRAND / VENDOR: Proteintech

Proteintech, 21277-1-AP, SR-BI Polyclonal antibody

CATALOG NUMBER: 21277-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SR-BI (21277-1-AP) by Proteintech is a Polyclonal antibody targeting SR-BI in WB, ELISA applications with reactivity to human, mouse, rat samples 21277-1-AP targets SR-BI in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HepG2 cells, human brain tissue, human testis tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15759 Product name: Recombinant human SCARB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-230 aa of BC022087 Sequence: MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISR Predict reactive species Full Name: scavenger receptor class B, member 1 Calculated Molecular Weight: 552 aa, 61 kDa Observed Molecular Weight: 61-82 kDa GenBank Accession Number: BC022087 Gene Symbol: SR-BI Gene ID (NCBI): 949 RRID: AB_10858921 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WTV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924