Iright
BRAND / VENDOR: Proteintech

Proteintech, 21281-1-AP, CRYGN Polyclonal antibody

CATALOG NUMBER: 21281-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRYGN (21281-1-AP) by Proteintech is a Polyclonal antibody targeting CRYGN in WB, ELISA applications with reactivity to human, mouse samples 21281-1-AP targets CRYGN in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15795 Product name: Recombinant human CRYGN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-182 aa of BC100880 Sequence: MAQRSGKITLYEGKHFTGQKLEVFGDCDNFQDRGFMNRVNSIHVESGAWVCFNHPDFRGQQFILEHGDYPDFFRWNSHSDHMGSCRPVGMHGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAAWSPRSFGAEDFQLSSSLQSDQGPEEATTKPATTQPPFLTANL Predict reactive species Full Name: crystallin, gamma N Calculated Molecular Weight: 182 aa, 21 kDa Observed Molecular Weight: 17 kDa, 25 kDa GenBank Accession Number: BC100880 Gene Symbol: CRYGN Gene ID (NCBI): 155051 RRID: AB_2878833 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXF5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924