Iright
BRAND / VENDOR: Proteintech

Proteintech, 21296-1-AP, MANEA Polyclonal antibody

CATALOG NUMBER: 21296-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MANEA (21296-1-AP) by Proteintech is a Polyclonal antibody targeting MANEA in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 21296-1-AP targets MANEA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15847 Product name: Recombinant human MANEA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-109 aa of BC146671 Sequence: LRPNTATFGAPFGLDLLPELHQRTIHLGKNFDFQKSDRINSETNTKNLKSVEITMKPSKASELNLDELPPLNNYLHVFYYS Predict reactive species Full Name: mannosidase, endo-alpha Calculated Molecular Weight: 462 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC146671 Gene Symbol: MANEA Gene ID (NCBI): 79694 RRID: AB_2878836 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5SRI9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924