Proteintech, 21316-1-AP, C5aR Polyclonal antibody

Size: 20ul / 150ul The C5aR (21316-1-AP) by Proteintech is a Polyclonal antibody targeting C5aR in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 21316-1-AP targets C5aR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, PC-3 cells, U-937 cells Positive IHC detected in: human tonsillitis tissue, human lung tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information C5aR, also named as CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production. The deduced sequence of C5aR contains 350 amino acids, giving a calculated molecular weight of 39 kDa. C5aR has an N-linked glycosylation site in the N-terminal extracellular domain. The apparent molecular weight of C5aR is about 40-52 kDa (PMID: 1847994; 9136907; 9136907; 2007135). Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15968 Product name: Recombinant human C5AR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 251-350 aa of BC008982 Sequence: FFIFWLPYQVTGIMMSFLEPSSPTFLLLNKLDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV Predict reactive species Full Name: complement component 5a receptor 1 Calculated Molecular Weight: 350 aa, 39 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC008982 Gene Symbol: C5aR Gene ID (NCBI): 728 RRID: AB_10733105 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21730 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.