Proteintech, 21337-1-AP, C3/C3b/C3c Polyclonal antibody

Size: 20ul / 150ul The C3/C3b/C3c (21337-1-AP) by Proteintech is a Polyclonal antibody targeting C3/C3b/C3c in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, rat samples 21337-1-AP targets C3/C3b/C3c in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat plasma, human plasma Positive IP detected in: human plasma tissue Positive IHC detected in: human liver tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The complement system is an important effector that bridges the innate and adaptive immune systems (PMID: 20010915). The third component of complement, C3, plays a central role in activating the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways (PMID: 11414361). Human C3 (190-195 kDa), composed of α and β chains (115-120 and 75 kDa, respectively), is cleaved into C3a and C3b by C3 convertase. C3b is composed of the α' chain and β chain (PMID: 27210597). Factor I cleaves the α′ chain of C3b to 68 kDa and 43 kDa degradation products (iC3b) (PMID: 25395424; 14527961). This antibody raised against 1314-1663 aa of human C3 protein recognizes the C3 α chain (115-120 kDa), C3b α' chain (110-115 kDa), and C3c α' chain fragment 2 (43 kDa). Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat, pig, monkey, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15537 Product name: Recombinant human C3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1314-1663 aa of BC150179 Sequence: ESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN Predict reactive species Full Name: complement component 3 Calculated Molecular Weight: 1663 aa, 187 kDa Observed Molecular Weight: 115 kDa GenBank Accession Number: BC150179 Gene Symbol: C3 Gene ID (NCBI): 718 RRID: AB_2878843 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01024 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.