Proteintech, 21346-1-AP, Sestrin 2 Polyclonal antibody

Size: 20ul / 150ul The Sestrin 2 (21346-1-AP) by Proteintech is a Polyclonal antibody targeting Sestrin 2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 21346-1-AP targets Sestrin 2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse thymus tissue, HEK-293 cells, HeLa cells, K-562 cells, mouse lung tissue, NIH/3T3 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Sestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 2 is implicated in the regulation of cell growth and survival, in cellular responses to different stress conditions, and also acts as a positive regulator of autophagy. Sestrin 2 is approximately a 57.6kDa protein (480 amino acids). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15669 Product name: Recombinant human SESN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of NM_031459 Sequence: MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAI Predict reactive species Full Name: sestrin 2 Calculated Molecular Weight: 480 aa, 54 kDa Observed Molecular Weight: 60-66 kDa GenBank Accession Number: NM_031459 Gene Symbol: SESN2/Sestrin 2 Gene ID (NCBI): 83667 RRID: AB_10733238 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.