Proteintech, 21347-1-AP, YIPF7 Polyclonal antibody

Size: 20ul / 150ul The YIPF7 (21347-1-AP) by Proteintech is a Polyclonal antibody targeting YIPF7 in IHC, ELISA applications with reactivity to human, mouse, rat samples 21347-1-AP targets YIPF7 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse brain tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information YIPF7, or Yip1 domain family, member 7, is a protein that is part of the YIPF protein family. It is involved in regulating membrane dynamics and may play a role in disease pathways. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15695 Product name: Recombinant human YIPF7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC103996 Sequence: MDLLKISHTKLHLLEDLSIKNKQRMSNLAQFDSDFYQSNFTIDNQEQSGNDSNAYGNLYGSRKQQAGEQPQPASFVPSEMLMSSGYAGQFFQPASNSDYYSQSPYIDSFD Predict reactive species Full Name: Yip1 domain family, member 7 Calculated Molecular Weight: 280 aa, 31 kDa GenBank Accession Number: BC103996 Gene Symbol: YIPF7 Gene ID (NCBI): 285525 RRID: AB_10734323 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N8F6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.