Proteintech, 21352-1-AP, SLC36A2 Polyclonal antibody

Size: 20ul / 150ul The SLC36A2 (21352-1-AP) by Proteintech is a Polyclonal antibody targeting SLC36A2 in WB, ELISA applications with reactivity to human, Mouse, Rat samples 21352-1-AP targets SLC36A2 in WB, ELISA applications and shows reactivity with human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information SLC36A2 encodes proton-coupled amino acid transporter 2 (PAT2), a high-affinity cotransporter of glycine and proline coupled with the uptake of a proton in kidney and muscles. The inactivation or reduced function of SLC36A2 is the predominant determinant of the inherited iminoglycinuria phenotype in humans. Specification Tested Reactivity: human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15742 Product name: Recombinant human SLC36A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC101101 Sequence: MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGT Predict reactive species Full Name: solute carrier family 36 (proton/amino acid symporter), member 2 Calculated Molecular Weight: 483 aa, 53 kDa Observed Molecular Weight: 53-60 kDa GenBank Accession Number: BC101101 Gene Symbol: SLC36A2 Gene ID (NCBI): 153201 RRID: AB_3085653 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q495M3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.