Iright
BRAND / VENDOR: Proteintech

Proteintech, 21390-1-AP, CCDC153 Polyclonal antibody

CATALOG NUMBER: 21390-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC153 (21390-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC153 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21390-1-AP targets CCDC153 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, HepG2 cells, L02 cells, human brain tissue, HeLa cells Positive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information CCDC153's properties have yet to be elucidated. However, research suggests that it may be a neuronal subtype marker (PMID: 28166221). It has a molecular weight of 24 KDa and is often observed on a Western blot as a dimer. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16044 Product name: Recombinant human CCDC153 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC101443 Sequence: MSRQCHALQEDMQTHSKQLEEEVKGLRGQLEACQREAAAAREEAEQALGERDQALAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGAALRLHARHKEQQRQFGLTPPGSLRPPAPSL Predict reactive species Full Name: coiled-coil domain containing 153 Calculated Molecular Weight: 210 aa, 24 kDa Observed Molecular Weight: 45-48 kDa GenBank Accession Number: BC101443 Gene Symbol: CCDC153 Gene ID (NCBI): 283152 RRID: AB_10858621 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q494R4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924