Proteintech, 21400-1-AP, SPATA13 Polyclonal antibody

Size: 20ul / 150ul The SPATA13 (21400-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA13 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21400-1-AP targets SPATA13 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, human placenta tissue Positive IF/ICC detected in: HepG2 cells, HEK-293 cells, Hela cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16101 Product name: Recombinant human SPATA13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC109291 Sequence: MTSASPEDQNAPVGCPKGARRRRPISVIGGVSLYGTNQTEELDNLLTQPASRPPMPAHQVPPYKAVSARFRPFTFSQSTPIGLDRVGRRRQMRASNVSSDGGTEPSALVDDNGSEEDFSYEDLCQASPRYLQPGG Predict reactive species Full Name: spermatogenesis associated 13 Calculated Molecular Weight: 652 aa, 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC109291 Gene Symbol: SPATA13 Gene ID (NCBI): 221178 RRID: AB_10859783 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96N96 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.