Proteintech, 21403-1-AP, MYH10 Polyclonal antibody

Size: 20ul / 150ul The MYH10 (21403-1-AP) by Proteintech is a Polyclonal antibody targeting MYH10 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21403-1-AP targets MYH10 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information MYH10 (non-muscle II-b, NM IIB) is a member of non-muscle myosin II which plays fundamental roles in the maintenance of cell morphology, cell adhesion, and migration, as well as cell division. MYH10 is mainly present in nerve cells, megakaryocytes, and other non-muscle cells. It has been reported to mediate centrosome reorientation during cell migration and contribute to ciliogenesis. Overexpression of MYH10 has been observed in breast cancer. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16113 Product name: Recombinant human MYH10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1183-1322 aa of BC150634 Sequence: QEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASL Predict reactive species Full Name: myosin, heavy chain 10, non-muscle Calculated Molecular Weight: 1985 aa, 230 kDa Observed Molecular Weight: 229 kDa GenBank Accession Number: BC150634 Gene Symbol: MYH10 Gene ID (NCBI): 4628 RRID: AB_10804351 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35580 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.