Iright
BRAND / VENDOR: Proteintech

Proteintech, 21411-1-AP, PLA2G4F Polyclonal antibody

CATALOG NUMBER: 21411-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLA2G4F (21411-1-AP) by Proteintech is a Polyclonal antibody targeting PLA2G4F in IHC, ELISA applications with reactivity to human samples 21411-1-AP targets PLA2G4F in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human prostate hyperplasia tissue, human bladder tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15571 Product name: Recombinant human PLA2G4F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-330 aa of BC146648 Sequence: ELTLYDKDILGSDQLSLLLFDLRSLKCGQPHKHTFPLNHQDSQELQVEFVLEKTQVPASEVITNGVLVAHPCLRIQGTLRGDGTAPREEYGSRQLQLAVPGAYEKPQLLPLQPPTEPGLPPTFTFHVNPVLSSRLHVELMEVLAAVQSGPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVALSMKVEMSSGDLDLRLGFDLSDGEQEFLDR Predict reactive species Full Name: phospholipase A2, group IVF Calculated Molecular Weight: 849 aa, 95 kDa GenBank Accession Number: BC146648 Gene Symbol: PLA2G4F Gene ID (NCBI): 255189 RRID: AB_10733354 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q68DD2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924