Proteintech, 21424-1-AP, CDC42SE2 Polyclonal antibody

Size: 20ul / 150ul The CDC42SE2 (21424-1-AP) by Proteintech is a Polyclonal antibody targeting CDC42SE2 in IHC, ELISA applications with reactivity to human samples 21424-1-AP targets CDC42SE2 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16011 Product name: Recombinant human CDC42SE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-84 aa of BC096703 Sequence: MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG Predict reactive species Full Name: CDC42 small effector 2 Calculated Molecular Weight: 84 aa, 9 kDa GenBank Accession Number: BC096703 Gene Symbol: CDC42SE2 Gene ID (NCBI): 56990 RRID: AB_2878856 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRR3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.