Iright
BRAND / VENDOR: Proteintech

Proteintech, 21457-1-AP, RHBDD3 Polyclonal antibody

CATALOG NUMBER: 21457-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RHBDD3 (21457-1-AP) by Proteintech is a Polyclonal antibody targeting RHBDD3 in WB, ELISA applications with reactivity to human samples 21457-1-AP targets RHBDD3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information RHBDD3, also named as C22orf3, controls autoimmunity by suppressing the production of IL-6 by dendritic cells via K27-linked ubiquitination of the regulator NEMO. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14737 Product name: Recombinant human RHBDD3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 184-386 aa of BC002705 Sequence: RWLEPSERRLQVLQEGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPYVASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLVGGQVGTETLVTHGKGGPAHSEGPGPP Predict reactive species Full Name: rhomboid domain containing 3 Calculated Molecular Weight: 386 aa, 40 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC002705 Gene Symbol: RHBDD3 Gene ID (NCBI): 25807 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3P4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924