Proteintech, 21466-1-AP, TMEM230 Polyclonal antibody

Size: 20ul / 150ul The TMEM230 (21466-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM230 in WB, IHC, ELISA applications with reactivity to human samples 21466-1-AP targets TMEM230 in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, COLO 320 cells, HEK-293 cells, HeLa cells Positive IHC detected in: human brain tissue, human colon cancer tissue, human liver cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The function of TMEM230/C20orf30 has not been widely studied, and is yet to be fully elucidated. TMEM230 is primarily a transmembrane protein of synaptic vesicles in neurons. Disease-linked TMEM230 mutants impair synaptic vesicle trafficking leading to Parkinson's disease. Two isoforms were produced by alternative splicing with predicted MW of 13 and 20 kDa. 13 kDa isoform accounts for >95% of the total protein isoforms(27270108). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15080 Product name: Recombinant human C20orf30 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-120 aa of BC011990 Sequence: MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD Predict reactive species Full Name: chromosome 20 open reading frame 30 Calculated Molecular Weight: 183 aa, 20 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC011990 Gene Symbol: TMEM230 Gene ID (NCBI): 29058 RRID: AB_10791969 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96A57 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.