Proteintech, 21516-1-AP, LHX6 Polyclonal antibody

Size: 20ul / 150ul The LHX6 (21516-1-AP) by Proteintech is a Polyclonal antibody targeting LHX6 in WB, ELISA applications with reactivity to human samples 21516-1-AP targets LHX6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information LHX6 is a LIM homeodomain protein similar in structure to ISL-1. LHX6, like ISL-1, contains tandem LIM domains and a homeodomain that regulate its activity both in cis and through interaction with cell-specific factors. LHX6 is highly expressed in the neural crest-derived mesenchyme throughout odontogenesis and down-regulated after birth. However, LHX6 is also expressed in the palate, oral, and dental epithelium during craniofacial development. LHX6 regulates the migration and specification of neuron subtypes and marks specific neurons. The molecular weight of Endogenous LHX6 is 40 kDa, but the LHX6-PITX2 protein complex is 56 kDa (PMID: 23229549). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16047 Product name: Recombinant human LHX6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 276-363 aa of BC103937 Sequence: KHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY Predict reactive species Full Name: LIM homeobox 6 Calculated Molecular Weight: 392 aa, 43 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC103937 Gene Symbol: LHX6 Gene ID (NCBI): 26468 RRID: AB_2878875 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPM6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.